PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_024612-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 371aa    MW: 41254.7 Da    PI: 7.8221
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_024612-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-17121166147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
    NNU_024612-RA 121 RGHWRPAEDAKLKELVAQYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 166
                      899*****************************.***********996 PP

2Myb_DNA-binding57.53e-18173216146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
    NNU_024612-RA 173 RRAFTEEEEERLLAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 216
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.718116167IPR017930Myb domain
SMARTSM007171.2E-14120169IPR001005SANT/Myb domain
PfamPF002493.6E-16121166IPR001005SANT/Myb domain
SuperFamilySSF466892.55E-28121214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-27122174IPR009057Homeodomain-like
CDDcd001678.95E-14124165No hitNo description
PROSITE profilePS5129427.188168222IPR017930Myb domain
SMARTSM007172.2E-15172220IPR001005SANT/Myb domain
PfamPF002491.1E-14173215IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-20175220IPR009057Homeodomain-like
CDDcd001671.20E-7184215No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MSLQHLQSTL CQRSDGEGLR AFAGASFLSP PSPLTLPLRI GGSTSEAKST AMAFQVLNDP  60
IELQKKEWGF QPLESRRMNG SEGGCNGYLG NQSTRAEEEE GENFVTGKDH ENGQQPKLCA  120
RGHWRPAEDA KLKELVAQYG PQNWNLIAEK LEGRSGKSCR LRWFNQLDPR INRRAFTEEE  180
EERLLAAHRL YGNKWAMIAR LFPGRTDNAV KNHWHVIMAR RHREQSSVYR RRKPSSSPAA  240
QKKIEMTNQN YACSDSTITS NRDESASTCT DLSLNSSSTR VTTSFFTRIS PHQNQRSFPS  300
EVNVGGSVNG FCNYTPKGMN MSVDQSGYSD SNSEISATES VANNHTGAGE IDYGNENFSL  360
PFIDFLGVGA T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-331212217107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245158.10.0PREDICTED: myb-related protein 330-like
RefseqXP_010245159.10.0PREDICTED: myb-related protein 330-like
RefseqXP_010245160.10.0PREDICTED: myb-related protein 330-like
TrEMBLB9IPV51e-120B9IPV5_POPTR; Uncharacterized protein
STRINGPOPTR_0019s05740.11e-120(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.18e-71myb domain protein 105